PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G16510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 1234aa    MW: 135009 Da    PI: 6.0608
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G16510.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.12.4e-15459498241
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                      ++k+C+CkkskClk+YCeCf+ag++Cse C+C++C Nk +
  OPUNC12G16510.1 459 SCKRCSCKKSKCLKLYCECFHAGVFCSEPCSCHGCLNKPS 498
                      689**********************************976 PP

2TCR41.92e-13958995340
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+C+CkkskClk+YC Cfa+g++Cse+C C+ C Nk+
  OPUNC12G16510.1 958 CKSCSCKKSKCLKLYCVCFASGSHCSESCGCDPCYNKS 995
                      79**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011149.6E-15458499IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163417.628459551IPR005172CRC domain
PfamPF036381.9E-11461496IPR005172CRC domain
Gene3DG3DSA:3.10.110.108.8E-24766855IPR016135Ubiquitin-conjugating enzyme/RWD-like
SuperFamilySSF544951.36E-25766858IPR016135Ubiquitin-conjugating enzyme/RWD-like
PROSITE profilePS5012713.975770853IPR000608Ubiquitin-conjugating enzyme E2
SMARTSM002125.6E-4770915No hitNo description
PfamPF001793.0E-9797853IPR000608Ubiquitin-conjugating enzyme E2
SMARTSM011144.5E-9956997IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163414.1329571040IPR005172CRC domain
PfamPF036383.6E-9959994IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 1234 aa     Download sequence    Send to blast
MDTPDRPPRA AAAAAAATAA VEDSPVFNFI NSLSPIPPPK PSDSAHNVQL FKSSDLAPVS  60
SIFASPHVNP AKESKLPIRE DSVQLSRESH SPNSVRTRTG ATSSIRMIRC KNIVSENCSI  120
TCYLNEPNSS KSSQSIQLCG GSAESDKNQN TDGKKDLSTE KVRTDLEFVL LDQSGPEKMD  180
SSQSGNNVCE NQLSEQHKDE LGSFDGGYMI AHQPDSDMLR LAPPFESETQ LVSETLQTDN  240
VYCESLLADG PGGSYIQNSA PDPHLYWAGA VEGSATDYTP QMLPGACQSQ LVPNDPICNK  300
LNEPSDYMPM DQNVSSQNLR GMRRRCLFNE KGGAANKGAK NTSVRHSTNS TTPRRKISSS  360
DNNLKTLRTP PCALPGIGLH LNALTTVPKD KTVPHNDTQS SLNQASNVPS AVDSSPPTAD  420
PHTVNADSSQ TAMVAYVGES SQGSPKKKRH KFDNGDGTSC KRCSCKKSKC LKLYCECFHA  480
GVFCSEPCSC HGCLNKPSNM ETVLSTREQI ESRNPLAFAP KVIRTEPGQE LAGGVGCSVS  540
CRCEGCKNAF GRREGVALLG IEETKRGCEE KDGGVKEETT DNDKQLVIYQ DSINLTPAES  600
VLATPSVVDC RPLVALPPLS SKKPRSSTKL GGYSSRLEGH LKSDILLSPF ESYAEMMLGD  660
GYILDYLWFL RGPDRQHLSL HQSWFYHALE FDDQPREFCF GKFCSEAEVI PCFLESGMPN  720
NNPVRVLYTY YQDVQITPRQ EPPVAGGSSA PEWHDAIVPA RLRRRVPRNF RLLEELERGE  780
KGIGDGSVSY GMDDADDIYM RSWTGTIIGP HNTVHEGRIY QLKLFCDKDY PDRPPTVKFH  840
SRINMTCVNP ENGLLEASGS DPDDPLLRVV PPPLPPPPPP PPTAPAPVLL APYENASAEA  900
AFAVPLPAAA VEANGNSEKK KKSVAFSPSP PRFFFCSVLV LLAFDFLIWR KADEGEGCKS  960
CSCKKSKCLK LYCVCFASGS HCSESCGCDP CYNKSIHGVP RSTPALPSKA VQTSEAGQDS  1020
VGGAGCSINC KCDDCKNPYG RKVGVILDGK NILAGPTPNE RNGTEADSSD DEEDDYYMNR  1080
PLSPVSPSPV SRESSFQQET LVGVEVQTMN GHLYPKPLTQ VRPESWQLTR RPTEEVRGEA  1140
WHYLRRPSED GTSDVMEGHA DPKFQRDNKQ LENHVDRYSI PRCIEVMNAM ADLSPIEKSL  1200
APDIFLDPSN REIFLSLTVD IRTMWLKRKM KSLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2a4d_A2e-3076585623114Ubiquitin-conjugating enzyme E2 variant 1
2hlw_A2e-3076585633124Ubiquitin-conjugating enzyme E2 variant 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0739420.0AK073942.1 Oryza sativa Japonica Group cDNA clone:J033075J10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620275.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A0E0MPE40.0A0A0E0MPE4_ORYPU; Uncharacterized protein
STRINGLOC_Os12g41230.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127462630
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-37TESMIN/TSO1-like CXC 2